SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345881 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345881
Domain Number 1 Region: 11-399
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.33e-152
Family GABA-aminotransferase-like 0.00000000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345881   Gene: ENSG00000176974   Transcript: ENST00000352886
Sequence length 403
Comment pep:known chromosome:GRCh37:17:18231195:18266721:-1 gene:ENSG00000176974 transcript:ENST00000352886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRA
VLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSG
SPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGY
INYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGV
VPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGGSDNHLILVDLRSKGTDGGRAEKVLEAC
SIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTG
VRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF
Download sequence
Identical sequences XP_011522294.1.92137 ENSP00000345881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]