SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000346440 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000346440
Domain Number 1 Region: 560-627
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000346440   Gene: ENSG00000196628   Transcript: ENST00000354452
Sequence length 671
Comment pep:known chromosome:GRCh37:18:52889562:53255860:-1 gene:ENSG00000196628 transcript:ENST00000354452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWG
NGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQG
CHQQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGL
PSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAG
MLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA
NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTA
VWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG
IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQ
SATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD
IKSITRSRSSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLK
SDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPG
MGDASNHMGQM
Download sequence
Identical sequences A0A2I3MAA3 A0A2J8UET0 A0A2K5W436 A0A2K6MRY5 H9ELW2
ENSP00000346440 ENSP00000455984 ENSNLEP00000009765 ENSP00000346440 ENSP00000455984 9600.ENSPPYP00000010306 9606.ENSP00000346440 ENSNLEP00000009765 NP_001077431.1.87134 NP_001077431.1.92137 XP_005586671.1.63531 XP_005586672.1.63531 XP_006722599.1.92137 XP_006722600.1.92137 XP_008950867.1.60992 XP_008950868.1.60992 XP_010374129.1.97406 XP_010374133.1.97406 XP_010374139.1.97406 XP_011731744.1.29376 XP_011731745.1.29376 XP_011924332.1.92194 XP_011924333.1.92194 XP_011924335.1.92194 XP_014977517.1.72884 XP_014977521.1.72884 XP_014977522.1.72884 XP_017705620.1.44346 XP_017705622.1.44346 XP_017705623.1.44346 XP_018869487.1.27298 XP_018869488.1.27298 gi|145312267|ref|NP_001077431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]