SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000346582 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000346582
Domain Number 1 Region: 41-116
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.11e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000346582   Gene: ENSG00000122691   Transcript: ENST00000354571
Sequence length 135
Comment pep:known chromosome:GRCh37:7:19152670:19156741:-1 gene:ENSG00000122691 transcript:ENST00000354571 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEA
FAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAF
SVWRMEGAWSMSASH
Download sequence
Identical sequences H7BY00
ENSP00000346582 ENSP00000346582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]