SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000347997 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000347997
Domain Number 1 Region: 15-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.84e-24
Family Ubiquitin-related 0.00000784
Further Details:      
 
Domain Number 2 Region: 600-654
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000185
Family UBA domain 0.00064
Further Details:      
 
Weak hits

Sequence:  ENSP00000347997
Domain Number - Region: 188-238
Classification Level Classification E-value
Superfamily ARM repeat 0.0311
Family Mo25 protein 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000347997   Gene: ENSG00000175520   Transcript: ENST00000311659
Sequence length 655
Comment pep:known chromosome:GRCh37:11:5528530:5531215:-1 gene:ENSG00000175520 transcript:ENST00000311659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGGEALPQGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQ
LVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKRQHRAMGNECPAASVPTQGPSPGSLPQP
SSIYPADGPPAFSLGLLTGLSRLGLAYRGFPDQPSSLMRQHVSVPEFVTQLIDDPFIPGL
LSNTGLVRQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQTLEFLRNPAMMQEMIRSQDRV
LSNLESIPGGYNVLCTMYTDIMDPMLNAVQEQFGGNPFATATTDNATTTTSQPSRMENCD
PLPNPWTSTHGGSGSRQGRQDGDQDAPDIRNRFPNFLGIIRLYDYLQQLHENPQSLGTYL
QGTASALSQSQEPPPSVNRVPPSSPSSQEPGSGQPLPEESVAIKGRSSCPAFLRYPTENS
TGQGGDQDGAGKSSTGHSTNLPDLVSGLGDSANRVPFAPLSFSPTAAIPGIPEPPWLPSP
AYPRSLRPDGMNPAPQLQDEIQPQLPLLMHLQAAMANPRALQALRQIEQGLQVLATEAPR
LLLWFMPCLAGTGSVAGGIESREDPLMSEDPLPNPPPEVFPALDSAELGFLSPPFLHMLQ
DLVSTNPQQLQPEAHFQVQLEQLRSMGFLNREANLQALIATGGDVDAAVEKLRQS
Download sequence
Identical sequences A0A140VJZ3 Q9H347
NP_059509.1.87134 NP_059509.1.92137 XP_011518446.1.92137 ENSP00000347997 ENSP00000347997 9606.ENSP00000347997 gi|8567418|ref|NP_059509.1| ENSP00000347997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]