SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000348374 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348374
Domain Number 1 Region: 556-623
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348374   Gene: ENSG00000196628   Transcript: ENST00000356073
Sequence length 667
Comment pep:known chromosome:GRCh37:18:52889565:53255860:-1 gene:ENSG00000196628 transcript:ENST00000356073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWG
NGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQG
CHQQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGL
PSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAG
MLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA
NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTA
VWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG
IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQ
SATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD
IKSITSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKP
QTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDA
SNHMGQM
Download sequence
Identical sequences A0A024R2C0 A0A2J8UEQ0 A0A2K5NQY9 H9ELW1 P15884
ENSP00000348374 ENSP00000457649 GO.78731 HR4645 NP_003190.1.87134 NP_003190.1.92137 XP_010374145.1.97406 XP_011731742.1.29376 XP_011924338.1.92194 XP_014977519.1.72884 XP_015295237.1.63531 XP_016881429.1.92137 XP_016881430.1.92137 XP_017705625.1.44346 XP_018869485.1.27298 gi|4507399|ref|NP_003190.1| ENSP00000348374 ENSP00000457649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]