SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000349931 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000349931
Domain Number 1 Region: 91-131,198-409
Classification Level Classification E-value
Superfamily RNI-like 2.55e-19
Family 28-residue LRR 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000349931   Gene: ENSG00000182330   Transcript: ENST00000357367
Sequence length 474
Comment pep:known chromosome:GRCh37:1:13386646:13390765:-1 gene:ENSG00000182330 transcript:ENST00000357367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIRAPPRLLELARQRLLRDQALAISTMEELPRELFPTLFMEAFSRRRCETLKTMVQAWP
FTRLPLGSLMKSPHLESLKSVLEGVDVLLTQEVRPRQSKLQVLDLRNVDENFCDIFSGAT
ASFPEALSQKQTADNCPGTGRQQPFMVFIDLCLKNRTLDECLTHLLEWGKQRKGLLHVCC
QELQVFGMPIHSIIEVLNMVELDCIQEVEVCCPWELSTLVKFAPYLGQMRNLRKLVLFNI
RASACIPPDNKGQFIARFTSQFLKLDYFQNLSMHSVSFLEGHLDQLLRCLQASLEMVVMT
DCLLSESDLKHLSWCPSIRQLKELDLRGVTLTHFSPEPLTGLLEQVVATLQTLDLEDCGI
MDSQLSAILPVLSRCSQLSTFSFCGNLISMAALENLLRHTVGLSKLSLELYPAPLESYDT
QGALCWGRFAELGAELMKTLRDLRQPKIIVFCTVPCPRCGIRASYDLEPSHCLC
Download sequence
Identical sequences ENSP00000349931 ENSP00000349931 9606.ENSP00000349931 gi|59676587|ref|NP_001012276.1| HR6108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]