SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000350871 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350871
Domain Number 1 Region: 47-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-40
Family SCAN domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 168-223
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-16
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350871   Gene: ENSG00000173258   Transcript: ENST00000358151
Sequence length 256
Comment pep:known chromosome:GRCh37:9:114287439:114340124:1 gene:ENSG00000173258 transcript:ENST00000358151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVVPLNKMTAISPEPQTLASTEQNEVPRVVTSGEQEAILRGNAADAESFRQRFRWFCY
SEVAGPRKALSQLWELCNQWLRPDIHTKEQILELLVFEQFLTILPGEIRIWVKSQHPESS
EEVVTLIEDLTQMLEEKDPVSQDSTVSQEENSKEDKMVTVCPNTESCESITLKDVAVNFS
RGEWKKLEPFQKELYKEVLLENLRNLEFLDFPVSKLELISQLKWVELPWLLEEVSKSSRL
DIHGAVKKMQMFSEAE
Download sequence
Identical sequences NP_001007170.1.87134 NP_001007170.1.92137 gi|55741870|ref|NP_001007170.1| ENSP00000350871 ENSP00000350871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]