SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000350928 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350928
Domain Number 1 Region: 111-593
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.85e-133
Family Pyridoxal-dependent decarboxylase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350928   Gene: ENSG00000128683   Transcript: ENST00000358196
Sequence length 594
Comment pep:known chromosome:GRCh37:2:171673072:171717661:1 gene:ENSG00000128683 transcript:ENST00000358196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEQSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
Download sequence
Identical sequences A0A0S2Z3V5 A0A2I2ZG24 Q99259
gi|58331246|ref|NP_000808.2| ENSP00000350928 NYSGXRC-T679 ENSP00000364421 NP_000808.2.87134 NP_000808.2.92137 XP_011509224.1.92137 XP_016859245.1.92137 XP_018878027.1.27298 ENSP00000350928 9606.ENSP00000350928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]