SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000350933 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350933
Domain Number 1 Region: 453-775
Classification Level Classification E-value
Superfamily RNI-like 5.65e-45
Family Cyclin A/CDK2-associated p19, Skp2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350933   Gene: ENSG00000197147   Transcript: ENST00000358200
Sequence length 803
Comment pep:known chromosome:GRCh37:1:89990462:90058936:1 gene:ENSG00000197147 transcript:ENST00000358200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITLTELKCLADAQSSYHILKPWWDVFWYYITLIMLLVAVLAGALQLTQSRVLCCLPCKV
EFDNHCAVPWDILKASMNTSSNPGTPLPLPLRIQNDLHRQQYSYIDAVCYEKQLHWFAKF
FPYLVLLHTLIFAACSNFWLHYPSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRP
LKLSKSKILLSSSGCSADIDSGKQSLPYPQPGLESAGIESPTSSVLDKKEGEQAKAIFEK
VKRFRMHVEQKDIIYRVYLKQIIVKVILFVLIITYVPYFLTHITLEIDCSVDVQAFTGYK
RYQCVYSLAEIFKVLASFYVILVILYGLTSSYSLWWMLRSSLKQYSFEALREKSNYSDIP
DVKNDFAFILHLADQYDPLYSKRFSIFLSEVSENKLKQINLNNEWTVEKLKSKLVKNAQD
KIELHLFMLNGLPDNVFELTEMEVLSLELIPEVKLPSAVSQLVNLKELRVYHSSLVVDHP
ALAFLEENLKILRLKFTEMGKIPRWVFHLKNLKELYLSGCVLPEQLSTMQLEGFQDLKNL
RTLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLELISCDLERI
PHSIFSLNNLHELDLRENNLKTVEEIISFQHLQNLSCLKLWHNNIAYIPAQIGALSNLEQ
LSLDHNNIENLPLQLFLCTKLHYLDLSYNHLTFIPEEIQYLSNLQYFAVTNNNIEMLPDG
LFQCKKLQCLLLGKNSLMNLSPHVGELSNLTHLELIGNYLETLPPELEGCQSLKRNCLIV
EENLLNTLPLPVTERLQTCLDKC
Download sequence
Identical sequences Q6P9F7
gi|197333692|ref|NP_001127948.1| gi|21245134|ref|NP_056165.1| NP_001127948.1.87134 NP_001127948.1.92137 NP_056165.1.87134 NP_056165.1.92137 XP_005270758.1.92137 XP_005270759.1.92137 XP_005270760.1.92137 XP_011539445.1.92137 XP_011539446.1.92137 XP_011539447.1.92137 XP_011539448.1.92137 XP_016856372.1.92137 XP_016856373.1.92137 XP_016856374.1.92137 ENSP00000350933 9606.ENSP00000332674 ENSP00000332674 ENSP00000400704 ENSP00000332674 ENSP00000350933 ENSP00000400704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]