SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000351175 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351175
Domain Number 1 Region: 13-93
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.23e-21
Family HLH, helix-loop-helix DNA-binding domain 0.00000571
Further Details:      
 
Weak hits

Sequence:  ENSP00000351175
Domain Number - Region: 76-131
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0732
Family Phase 1 flagellin 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351175   Gene: ENSG00000125952   Transcript: ENST00000358402
Sequence length 151
Comment pep:known chromosome:GRCh37:14:65541842:65569222:-1 gene:ENSG00000125952 transcript:ENST00000358402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATE
YIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGS
TISAFDGGSDSSSESEPEEPQSRKKLRMEAS
Download sequence
Identical sequences A0A287CXZ2 A0A2I3H4F8 A0A2I3LTK7 A0A2J8WLY2 A0A2K5LSM5 A0A2K5RBD0 A0A2K6A7Q2 A0A2K6BTH0 A0A2K6GBI0 A0A2K6QVV2 A0A2K6UI59 F7FVQ8 G3UIG8 K7C871 K9IYB1 L9L7F1 Q4R7R4 U3DBN1
ENSSSCP00000002476 NP_001248298.1.72884 NP_001272145.1.63531 NP_660087.1.87134 NP_660087.1.92137 XP_002824898.1.23681 XP_003267863.1.23891 XP_003408764.1.64505 XP_003824093.1.60992 XP_003924484.1.74449 XP_004262183.1.21590 XP_004409434.1.74151 XP_004612407.1.94378 XP_004649320.1.11716 XP_004681834.1.23501 XP_004698715.1.18182 XP_004739000.1.14098 XP_005322854.1.77405 XP_005666374.1.46622 XP_006142474.1.99106 XP_006207025.1.17985 XP_006738679.1.47382 XP_006873121.1.41390 XP_006891870.1.29581 XP_007116423.1.24612 XP_007940482.1.48129 XP_007985180.1.81039 XP_008581161.1.73410 XP_010382015.1.97406 XP_010960572.1.22495 XP_011216025.1.58354 XP_011725956.1.29376 XP_011833706.1.47321 XP_011909202.1.92194 XP_012511699.1.63892 XP_012633191.1.48125 XP_016079353.1.3490 XP_017389502.1.71028 XP_019307088.1.44245 XP_019307089.1.44245 XP_019778174.1.83887 XP_021556996.1.83697 XP_510008.3.37143 XP_866524.1.84170 ENSSSCP00000002476 ENSMMUP00000005813 ENSLAFP00000027626 gi|21704263|ref|NP_660087.1| ENSP00000351175 ENSP00000351175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]