SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000351258 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351258
Domain Number 1 Region: 89-160
Classification Level Classification E-value
Superfamily RNI-like 0.000000314
Family Cyclin A/CDK2-associated p19, Skp2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351258   Gene: ENSG00000125375   Transcript: ENST00000358473
Sequence length 266
Comment pep:novel chromosome:GRCh37:14:50785952:50802276:1 gene:ENSG00000125375 transcript:ENST00000358473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRGSGAEACSNEDGCSEKGMKGVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKD
YNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQL
ENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGAGNPGPCVASGSSRTRAP
LGFRERGLQETDVPGALVDRSYDLSPSAGMRMLELKATTAILKSRFQLSVPGGSLLFKQS
PVGHSSISFWPYKAILRQSRAGDNQE
Download sequence
Identical sequences Q8WXQ4
ENSP00000351258 ENSP00000351258 ENSP00000389246 ENSP00000451628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]