SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000352039 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000352039
Domain Number 1 Region: 628-874
Classification Level Classification E-value
Superfamily RNI-like 6.47e-59
Family 28-residue LRR 0.02
Further Details:      
 
Domain Number 2 Region: 863-1028
Classification Level Classification E-value
Superfamily RNI-like 1.13e-41
Family 28-residue LRR 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSP00000352039
Domain Number - Region: 144-224,259-300
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000218
Family Nitrogenase iron protein-like 0.091
Further Details:      
 
Domain Number - Region: 538-575
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0863
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000352039   Gene: ENSG00000167984   Transcript: ENST00000359128
Sequence length 1036
Comment pep:known chromosome:GRCh37:16:3589038:3627401:-1 gene:ENSG00000167984 transcript:ENST00000359128 gene_biotype:polymorphic_pseudogene transcript_biotype:protein_coding
Sequence
MRKQEVRTGREAGQGHGTGSPAEQVKALMDLLAGKGSQGSQAPQALDRTPDAPLGPCSND
SRIQRHRKALLSKVGGGPELGGPWHRLASLLLVEGLTDLQLREHDFTQVEATRGGGHPAR
TVALDRLFLPLSRVSVPPRVSITIGVAGMGKTTLVRHFVRLWAHGQVGKDFSLVLPLTFR
DLNTHEKLCADRLICSVFPHVGEPSLAVAVPARALLILDGLDECRTPLDFSNTVACTDPK
KEIPVDHLITNIIRGNLFPEVSIWITSRPSASGQIPGGLVDRMTEIRGFNEEEIKVCLEQ
MFPEDQALLGWMLSQVQADRALYLMCTVPAFCRLTGMALGHLWRSRTGPQDAELWPPRTL
CELYSWYFRMALSGEGQEKGKASPRIEQVAHGGRKMVGTLGRLAFHGLLKKKYVFYEQDM
KAFGVDLALLQGAPCSCFLQREETLASSVAYCFTHLSLQEFVAAAYYYGASRRAIFDLFT
ESGVSWPRLGFLTHFRSAAQRAMQAEDGRLDVFLRFLSGLLSPRVNALLAGSLLAQGEHQ
AYRTQVAELLQGCLRPDAAVCARAINVLHCLHELQHTELARSVEEAMESGALARLTGPAH
RAALAYLLQVSDACAQEANLSLSLSQGVLQSLLPQLLYCRKLRLDTNQFQDPVMELLGSV
LSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKI
NRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADLKQNRSLK
ELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSL
RENSISPEGAQAIAHALCANSTLKNLDLQWNFIQAGAAQALGQALQLNRSLTSLDLQENA
IGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILDLRGNAIGVA
GAKALANALKVNSSLRRLNLQENSLGMDGAICIATALSGNHRLQHINLQGNHIGDSGARM
ISEAIKTNAPTCTVEM
Download sequence
Identical sequences ENSP00000352039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]