SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000352683 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000352683
Domain Number 1 Region: 6-272
Classification Level Classification E-value
Superfamily RNI-like 5.89e-43
Family Cyclin A/CDK2-associated p19, Skp2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000352683   Gene: ENSG00000145743   Transcript: ENST00000359660
Sequence length 303
Comment pep:known chromosome:GRCh37:5:107194736:107717111:-1 gene:ENSG00000145743 transcript:ENST00000359660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQ
LGSKCRELKDIHFGQCYKISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPEL
QYVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWI
INDRCVEVIAKEGQNLKELYLVSCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLI
AQSSKSLRYLGLMRCDKVNEVTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSA
ASS
Download sequence
Identical sequences A0A2J8L7Q5 A0A2J8XES1
XP_018883872.1.27298 NYSGRC-45238580 ENSP00000352683 ENSP00000352683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]