SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000354371 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354371
Domain Number 1 Region: 90-131,198-409
Classification Level Classification E-value
Superfamily RNI-like 2.55e-19
Family 28-residue LRR 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354371   Gene: ENSG00000204510   Transcript: ENST00000361079
Sequence length 474
Comment pep:known chromosome:GRCh37:1:12976450:12980569:1 gene:ENSG00000204510 transcript:ENST00000361079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIRAPPRLLELARQRLLRDQALAISTMEELPRELFPTLFMEAFSRRRCETLKTMVQAWP
FTRLPLGSLMKSPHLESLKSVLEGVDVLLTQEVRPRQSKLQVLDLRNVDENFCDIFSGAT
ASFPEALSQKQTADNCPGTGRQQPFMVFIDLCLKNRTLDECLTHLLEWGKQRKGLLHVCC
KELQVFGMPIHSIIEVLNMVELDCIQEVEVCCPWELSTLVKFAPYLGQMRNLRKLVLFNI
RASACIPPDNKGQFIARFTSQFLKLDYFQNLSMHSVSFLEGHLDQLLRCLQASLEMVVMT
DCLLSESDLKHLSWCPSIRQLKELDLRGVTLTHFSPEPLTGLLEQVVATLQTLDLEDCGI
MDSQLSAILPVLSRCSQLSTFSFCGNLISMAALENLLRHTVGLSKLSLELYPAPLESYDT
QGALCWGRFAELGAELMKTPRDLRQPKIIVFCTVPCPRCGIRASYDLEPSHCLC
Download sequence
Identical sequences HR6106 gi|59676593|ref|NP_001012277.1| ENSP00000328915 9606.ENSP00000328915 ENSP00000328915 ENSP00000354371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]