SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000354606 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354606
Domain Number 1 Region: 32-98
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0000963
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354606   Gene: ENSG00000119950   Transcript: ENST00000361248
Sequence length 182
Comment pep:known chromosome:GRCh37:10:111969989:112046264:1 gene:ENSG00000119950 transcript:ENST00000361248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRRAHLRLCLERLKVLIPLGPDCTRHTTL
GLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTIS
SDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSF
TS
Download sequence
Identical sequences A0A0S2Z3X5 A0A2J8PCL1 A0A2J8W795
ENSP00000354606 gi|57242784|ref|NP_001008541.1| GO.40685 NP_001008541.1.87134 NP_001008541.1.92137 XP_003255503.1.23891 XP_011783289.1.43180 XP_011783291.1.43180 XP_011822942.1.47321 XP_011822943.1.47321 XP_011898261.1.92194 XP_012361242.1.23891 XP_016774801.1.37143 ENSP00000354606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]