SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000355877 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355877
Domain Number 1 Region: 58-192
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 6.93e-38
Family MOSC N-terminal domain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 52-108,213-334
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 1.41e-20
Family MOSC (MOCO sulphurase C-terminal) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355877   Gene: ENSG00000186205   Transcript: ENST00000366910
Sequence length 337
Comment pep:known chromosome:GRCh37:1:220960101:220987730:1 gene:ENSG00000186205 transcript:ENST00000366910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQ
LWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCD
GDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRL
VHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPN
IVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQC
DPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ
Download sequence
Identical sequences Q5VT66
ENSP00000355877 gi|224600454|ref|NP_073583.3| ENSP00000355877 9606.ENSP00000355877 ENSP00000355877 NP_073583.3.87134 NP_073583.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]