SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000355880 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355880
Domain Number 1 Region: 57-191
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 2.62e-39
Family MOSC N-terminal domain-like 0.0047
Further Details:      
 
Domain Number 2 Region: 52-107,212-331
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 1.36e-17
Family MOSC (MOCO sulphurase C-terminal) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355880   Gene: ENSG00000117791   Transcript: ENST00000366913
Sequence length 335
Comment pep:known chromosome:GRCh37:1:220921676:220958150:1 gene:ENSG00000117791 transcript:ENST00000366913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASSSSALARLGLPARPWPRWLGVAALGLAAVALGTVAWRRAWPRRRRRLQQVGTVAKL
WIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVIKEDGHMVTARQEPRLVLISIIYEN
NCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLV
QFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNTRMEKKMKMENFRPNI
VVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPDTGVIDRKQPLDTLKSYRLCD
PSERELYKLSPLFGIYYSVEKIGSLRVGDPVYRMV
Download sequence
Identical sequences Q969Z3
ENSP00000355880 ENSP00000355880 ENSP00000355880 gi|31542713|ref|NP_060368.2| NP_001304267.1.87134 NP_001304267.1.92137 NP_060368.2.87134 NP_060368.2.92137 9606.ENSP00000355880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]