SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000356247 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356247
Domain Number 1 Region: 47-314
Classification Level Classification E-value
Superfamily L domain-like 1.53e-57
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 229-477
Classification Level Classification E-value
Superfamily RNI-like 3.53e-43
Family Rna1p (RanGAP1), N-terminal domain 0.045
Further Details:      
 
Domain Number 3 Region: 545-844
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.48e-28
Family Rhodopsin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356247   Gene: ENSG00000133067   Transcript: ENST00000367278
Sequence length 967
Comment pep:known chromosome:GRCh37:1:202163029:202288909:1 gene:ENSG00000133067 transcript:ENST00000367278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPPGLRALWLCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAV
PGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILM
LQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVR
ALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLD
LNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSA
FQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELS
HNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFST
LHSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCC
PYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPH
PSVQCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFV
VGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWETGLGCRATGFLAVLGSEASVLLL
TLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVGEYGASPLCLPY
APPEGQPAALGFTVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIF
ADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRR
LRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVT
LISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSGGGGFQPSG
LAFASHV
Download sequence
Identical sequences Q9HBX8
gi|62912470|ref|NP_001017403.1| NP_001017403.1.87134 NP_001017403.1.92137 ENSP00000255432 9606.ENSP00000356247 ENSP00000356247 ENSP00000356247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]