SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000356694 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356694
Domain Number 1 Region: 144-281
Classification Level Classification E-value
Superfamily TNF-like 3.63e-37
Family TNF-like 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSP00000356694
Domain Number - Region: 55-73
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00366
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 
Domain Number - Region: 2-68
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0314
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356694   Gene: ENSG00000117560   Transcript: ENST00000367721
Sequence length 281
Comment pep:known chromosome:GRCh37:1:172628158:172636014:1 gene:ENSG00000117560 transcript:ENST00000367721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQ
MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGG
LVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA
RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Download sequence
Identical sequences P48023 Q53ZZ1
gi|4557329|ref|NP_000630.1| NP_000630.1.87134 NP_000630.1.92137 OPTIC7279 ENSP00000356694 ENSP00000344739 9606.ENSP00000356694 ENSP00000356694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]