SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000356766 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356766
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-29
Family C-type lectin domain 0.000000238
Further Details:      
 
Domain Number 2 Region: 262-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 200-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 379-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000959
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 5 Region: 317-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 458-523
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000709
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 513-578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000389
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 8 Region: 162-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000108
Family EGF-type module 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356766   Gene: ENSG00000174175   Transcript: ENST00000367792
Sequence length 646
Comment pep:known chromosome:GRCh37:1:169558090:169599377:-1 gene:ENSG00000174175 transcript:ENST00000367792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC
QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPS
KLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
PEVVQCTASGVWTAPAPVCKAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFML
RGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGL
LLVGASVLQCLATGNWNSVPPECQGKSIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGF
NTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNF
SYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVASTIG
LIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
Download sequence
Identical sequences Q5R342
ENSP00000356766 ENSP00000399368 ENSP00000399368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]