SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000356998 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356998
Domain Number 1 Region: 164-240
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.75e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356998   Gene: ENSG00000158773   Transcript: ENST00000368019
Sequence length 282
Comment pep:novel chromosome:GRCh37:1:161009645:161013149:-1 gene:ENSG00000158773 transcript:ENST00000368019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP
STAVGDGAGGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVE
RRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGL
DQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHGLEVVIKNDSN
Download sequence
Identical sequences A0A2J8JAL4 A0A2J8VHR4 B1AQP1
ENSP00000356998 ENSP00000356998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]