SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357269 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357269
Domain Number 1 Region: 2-368
Classification Level Classification E-value
Superfamily Sema domain 2.35e-116
Family Sema domain 0.000000143
Further Details:      
 
Domain Number 2 Region: 364-415
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000262
Family Plexin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSP00000357269
Domain Number - Region: 427-506
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0396
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357269   Gene: ENSG00000196189   Transcript: ENST00000368286
Sequence length 629
Comment pep:known chromosome:GRCh37:1:156123388:156147534:1 gene:ENSG00000196189 transcript:ENST00000368286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPWPASDRKKSECAFKKKSNEELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGM
LYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETAS
EFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPA
DSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTYRGPET
NPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAVETAQGLDGHSHL
VMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRV
PRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPM
SRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPEASSTVYNGSLLL
IVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGA
ALAAQQSYWPHFVTVTVLFALVLSGALIILVASPLRALRARGKVQGCETLRPGEKAPLSR
EQHLQSPKECRTSASDVDADNNCLGTEVA
Download sequence
Identical sequences ENSP00000357267 ENSP00000357269 ENSP00000357267 gi|300863076|ref|NP_001180231.1| NP_001180231.1.87134 NP_001180231.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]