SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357349 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357349
Domain Number 1 Region: 65-117
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000497
Family Hairy Orange domain 0.00013
Further Details:      
 
Domain Number 2 Region: 3-59
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000772
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357349   Gene: ENSG00000135547   Transcript: ENST00000368365
Sequence length 291
Comment pep:known chromosome:GRCh37:6:126068810:126082415:1 gene:ENSG00000135547 transcript:ENST00000368365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQAT
GGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCATQREA
AAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPNGLHASESTPCRLSTTSEVPPAHGSAL
LTATFAHADSALRMPSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAF
PMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF
Download sequence
Identical sequences A0A2I3STK1 Q5TF93
ENSP00000357349 ENSP00000357349 XP_008951200.1.60992 XP_008951201.1.60992 XP_008951202.1.60992 XP_008951203.1.60992 XP_009450215.1.37143 XP_009450216.1.37143 XP_009450217.1.37143 XP_009450218.1.37143 XP_016866116.1.92137 XP_016866117.1.92137 XP_016866118.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]