SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357838 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357838
Domain Number 1 Region: 39-436
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.55e-241
Family GABA-aminotransferase-like 0.000000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357838   Gene: ENSG00000065154   Transcript: ENST00000368845
Sequence length 439
Comment pep:known chromosome:GRCh37:10:126085876:126107505:-1 gene:ENSG00000065154 transcript:ENST00000368845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSKLAHLQRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPV
ALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVL
GEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGR
TLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVV
PDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYP
VSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNEL
MKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI
KEDELRESIEIINKTILSF
Download sequence
Identical sequences A0A140VJQ4 H2Q2Q6 P04181
gi|4557809|ref|NP_000265.1| ENSPTRP00000005344 9598.ENSPTRP00000005344 9606.ENSP00000357838 ENSP00000357838 ENSP00000357838 NP_000265.1.87134 NP_000265.1.92137 NP_001309894.1.87134 NP_001309894.1.92137 NP_001309895.1.87134 NP_001309895.1.92137 NP_001309896.1.87134 NP_001309896.1.92137 NP_001309897.1.87134 NP_001309897.1.92137 NP_001309898.1.87134 NP_001309898.1.92137 NP_001309899.1.87134 NP_001309899.1.92137 XP_008967612.1.60992 XP_009457720.1.37143 XP_009457721.1.37143 XP_009457722.1.37143 XP_014202121.1.60992 ENSPTRP00000005344 1oat_A 1oat_B 1oat_C 2oat_A 2oat_B 2oat_C 2oatA 399912 ENSP00000357838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]