SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358121 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358121
Domain Number 1 Region: 522-687
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 7.46e-61
Family Hect, E3 ligase catalytic domain 0.00000949
Further Details:      
 
Domain Number 2 Region: 33-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.22e-57
Family Ankyrin repeat 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSP00000358121
Domain Number - Region: 248-329,485-518
Classification Level Classification E-value
Superfamily ARM repeat 0.0599
Family Clathrin adaptor core protein 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358121   Gene: ENSG00000085382   Transcript: ENST00000369125
Sequence length 694
Comment pep:novel chromosome:GRCh37:6:105176797:105307794:-1 gene:ENSG00000085382 transcript:ENST00000369125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAMEQLNRLTRSLRRARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYA
FGRVKRSLLHIAANCGSVECLVLLLKKGANPNYQDISGCTPLHLAARNGQKKCMSKLLEY
SADVNICNNEGLTAIHWLAVNGRTELLHDLVQHVSDVDVEDAMGQTALHVACQNGHKTTV
QCLLDSGADINRPNVSGATPLYFACSHGQRDTAQILLLRGAKYLPDKNGVTPLDLCVQGG
YGETCEVLIQYHPRLFQTIIQMTQNEDLRENMLRQVLEHLSQQSESQYLKILTSLAEVAT
TNGHKLLSLSSNYDAQMKSLLRIVRMFCHVFRIGPSSPSNGIDMGYNGNKTPRSQVFKPL
ELLWHSLDEWLVLIATELMKNKRDSTEITSILLKQKGQDQDAASIPPFEPPGPGSYENLS
TGTRESKPDALAGRQEASADCQDVISMTANRLSAVIQAFYMCCSCQMPPGMTSPRFIEFV
CKHDEVLKCFVNRNPKIIFDHFHFLLECPELMSRFMHIIKAQAEYVQLVTELRMTRAIQP
QINAFLQGFHMFIPPSLIQLFDEYELELLLSGMPEIDVSDWIKNTEYTSGYEREDPVIQW
FWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSST
CINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA
Download sequence
Identical sequences A0A2I3T5Y9 A0A2J8SG30
ENSP00000358121 ENSP00000358121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]