SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358625 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358625
Domain Number 1 Region: 28-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000497
Family HLH, helix-loop-helix DNA-binding domain 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358625   Gene: ENSG00000119950   Transcript: ENST00000369612
Sequence length 192
Comment pep:known chromosome:GRCh37:10:111987437:112044806:1 gene:ENSG00000119950 transcript:ENST00000369612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPL
GPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERI
RMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEG
YSSASVKLSFTS
Download sequence
Identical sequences A0A0S2Z3Y0 A0A2J8PCL7 A0A2J8W782 A0A2K5I0W4
XP_003255496.1.23891 XP_003255497.1.23891 XP_003255500.1.23891 XP_003255501.1.23891 XP_003825622.1.60992 XP_004087588.1.23891 XP_004087589.1.23891 XP_004087590.1.23891 XP_008949145.1.60992 XP_008949146.1.60992 XP_008949148.1.60992 XP_008949149.1.60992 XP_008949150.1.60992 XP_011713945.1.29376 XP_011713954.1.29376 XP_011713960.1.29376 XP_011783282.1.43180 XP_011783283.1.43180 XP_011783284.1.43180 XP_011783285.1.43180 XP_011783286.1.43180 XP_011783287.1.43180 XP_011783288.1.43180 XP_012361240.1.23891 XP_015003624.1.72884 XP_015003625.1.72884 XP_015003626.1.72884 XP_015312147.1.63531 XP_015312148.1.63531 XP_017742669.1.44346 XP_017742670.1.44346 XP_017742671.1.44346 ENSP00000358625 ENSP00000358625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]