SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358773 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358773
Domain Number 1 Region: 13-190
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.88e-23
Family Protein-L-isoaspartyl O-methyltransferase 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSP00000358773
Domain Number - Region: 314-332
Classification Level Classification E-value
Superfamily SOCS box-like 0.0785
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358773   Gene: ENSG00000203880   Transcript: ENST00000369758
Sequence length 334
Comment pep:known chromosome:GRCh37:20:62887094:62907006:1 gene:ENSG00000203880 transcript:ENST00000369758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGN
IHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEY
AKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNL
LKVGGILVMPLEEKPCHSESGKSRLVQLPPVAVRSLQDLARIAIRGTIKKIIHQETVSKN
GNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDLEEERREEEEKTPP
ETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYREK
Download sequence
Identical sequences H2QKU4
ENSP00000358773 gi|157388997|ref|NP_001098395.1| NP_001098395.1.87134 NP_001098395.1.92137 XP_003317122.1.37143 XP_008960568.1.60992 XP_009435975.1.37143 ENSP00000358773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]