SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358953 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000358953
Domain Number - Region: 149-188
Classification Level Classification E-value
Superfamily UBA-like 0.00187
Family CUE domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358953   Gene: ENSG00000107874   Transcript: ENST00000369937
Sequence length 287
Comment pep:known chromosome:GRCh37:10:104183002:104192418:-1 gene:ENSG00000107874 transcript:ENST00000369937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEM
MEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEML
KEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQ
MLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEA
PKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH
Download sequence
Identical sequences A0A2I3GD53 A0A2K6MZA4 A0A2K6RMA6 G3QVR5 K7CM68 Q9H467
9598.ENSPTRP00000005097 9606.ENSP00000358953 ENSPTRP00000005097 gi|148596996|ref|NP_076945.2| ENSPTRP00000005097 ENSNLEP00000018397 ENSNLEP00000018397 NP_076945.2.87134 NP_076945.2.92137 XP_003255446.1.23891 XP_004050068.1.27298 XP_010354472.1.97406 XP_017707196.1.44346 XP_018890198.1.27298 ENSP00000358953 ENSP00000358953 ENSP00000358953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]