SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358972 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358972
Domain Number 1 Region: 75-262
Classification Level Classification E-value
Superfamily RNI-like 4.51e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.013
Further Details:      
 
Domain Number 2 Region: 14-52
Classification Level Classification E-value
Superfamily F-box domain 0.00000471
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358972   Gene: ENSG00000107872   Transcript: ENST00000369956
Sequence length 296
Comment pep:known chromosome:GRCh37:10:104179589:104182893:1 gene:ENSG00000107872 transcript:ENST00000369956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLAGLRR
FDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVALGGC
GQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAI
VYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSDGVRTLAEYC
PVLRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV
Download sequence
Identical sequences A0A0C4DFV0
GO.38408 ENSP00000358972 ENSP00000358972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]