SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359516 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359516
Domain Number 1 Region: 40-152
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.42e-21
Family AAT-like 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359516   Gene: ENSG00000137944   Transcript: ENST00000370485
Sequence length 167
Comment pep:known chromosome:GRCh37:1:89401542:89458287:-1 gene:ENSG00000137944 transcript:ENST00000370485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEYNACTVKFTNLKCTAG
Download sequence
Identical sequences ENSP00000359516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]