SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359722 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359722
Domain Number 1 Region: 36-254
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-81
Family Protein kinases, catalytic subunit 0.00000000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359722   Gene: ENSG00000142875   Transcript: ENST00000370688
Sequence length 257
Comment pep:known chromosome:GRCh37:1:84543827:84671122:1 gene:ENSG00000142875 transcript:ENST00000370688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKNF
Download sequence
Identical sequences A0A2J8K891 A0A2J8WQF3 H9FWY2
ENSP00000359722 NP_997461.1.87134 NP_997461.1.92137 XP_005542969.1.63531 XP_007976354.1.81039 XP_009246834.1.23681 XP_011741322.1.29376 XP_011833182.1.47321 XP_011932325.1.92194 XP_012355934.1.23891 XP_014999252.1.72884 XP_018877953.1.27298 ENSP00000359722 gi|46909587|ref|NP_997461.1| ENSMMUP00000004603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]