SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360558 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000360558
Domain Number - Region: 110-171
Classification Level Classification E-value
Superfamily RNI-like 0.000445
Family 28-residue LRR 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360558   Gene: ENSG00000146221   Transcript: ENST00000371503
Sequence length 198
Comment pep:known chromosome:GRCh37:6:44247897:44265458:-1 gene:ENSG00000146221 transcript:ENST00000371503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFERHLENLLKHFIPGTTDPAVILDLLPLCRNYVRRVHVDQFLPPVQLPAQLRPGDQSD
SGSEGEMEEPTVDHYQLGDLVAGLSHLEELDLVYDVKDCGMNFEWNLFLFTYRDCLSLAA
AIKACHTLKDGGKQLLEGMSDNKTLLEFDLRLSDVAQESEYLIGQALYANREAARQRALN
PSHFMSTITANGPENSVG
Download sequence
Identical sequences G3QXH9 Q5JU01
ENSP00000360559 ENSP00000360558 ENSP00000360559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]