SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360583 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360583
Domain Number 1 Region: 381-635,664-745
Classification Level Classification E-value
Superfamily ARM repeat 5.38e-39
Family Armadillo repeat 0.064
Further Details:      
 
Domain Number 2 Region: 99-307
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000549
Family 28-residue LRR 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360583   Gene: ENSG00000203995   Transcript: ENST00000371528
Sequence length 759
Comment pep:known chromosome:GRCh37:1:53308408:53360670:1 gene:ENSG00000203995 transcript:ENST00000371528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFLHPGHTPRNIVPPDAQKDALGCCVVQEEASPYTLVNICLNVLIANLEKLCSERPDG
TLCLPEHWSFPQEVAERFLRVMTWQGKLTDRTASIFRGNQMKLKLVNIQKAKISTAAFIK
AFCRHKLIELNATAVHADLPVPDIISGLCSNRWIQQNLQCLLLDSTSIPQNSRLLFFSQL
TGLRILSVFNVCFHTEDLANVSQLPRLESLDISNTLVTDISALLTCKDRLKSLTMHYLKC
LAMTKSQILAVIRELKCLLHLDISDHRQLKSDLAFHLLQQKDILPNVVSLDISGGNCITD
EAVELFIRLRPAMQFVGLLATDAGSSDFFTTKQGLRVAGGASMSQISEALSRYRNRSCFV
KEALHRLFTETFSMEVTMPAILKLVAIGMRNHPLDLRVQFTASACALNLTRQGLAKGMPV
RLLSEVTCLLFKALKNFPHYQQLQKNCLLSLTNSRILVDVPFDRFDAAKFVMRWLCKHEN
PKMQTMAVSVTSILALQLSPEQTAQLEELFMAVKELLAIVKQKTTENLDDVTFLFTLKAL
WNLTDGSPAACKHFIENQGLQIFIQVLETFSESAIQSKVLGLLNNIAEVRELSSKLVTED
VLKHINSLLCSREMEVSYFAAGIIAHLTSDRQLWISRDFQRRTLLQDLHATIQNWPSSSC
KMTALVTYRSFKTFFPLLGNFSQPEVQLWALWAMYHVCSKNPSKYCKMLVEEEGLQLLCD
IQEHSEATPKAQQIAASILDDFRMHFMNYQRPTLCQMPF
Download sequence
Identical sequences Q6WRX3
9606.ENSP00000360583 ENSP00000360583 gi|226437632|ref|NP_001004339.2| ENSP00000360587 NP_001004339.2.87134 NP_001004339.2.92137 ENSP00000360583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]