SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360950 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360950
Domain Number 1 Region: 189-254
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360950   Gene: ENSG00000162367   Transcript: ENST00000371883
Sequence length 333
Comment pep:known chromosome:GRCh37:1:47681963:47695443:-1 gene:ENSG00000162367 transcript:ENST00000371883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGP
GGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQ
LSPPALAAPAAPGRALLYSLSQPLASLGSHSGFFGEPDAFPMFTTNNRVKRRPSPYEMEI
TDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINF
LAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGA
ASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR
Download sequence
Identical sequences ENSP00000360950 ENSP00000360950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]