SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360951 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360951
Domain Number 1 Region: 187-252
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360951   Gene: ENSG00000162367   Transcript: ENST00000371884
Sequence length 331
Comment pep:known chromosome:GRCh37:1:47681962:47697387:-1 gene:ENSG00000162367 transcript:ENST00000371884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGP
GGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQ
LSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITD
GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA
KLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAAS
PDSYTEEPAPKHTARSLHPAMLPAADGAGPR
Download sequence
Identical sequences P17542
ENSP00000294339 ENSP00000360951 9606.ENSP00000294339 ENSP00000294339 ENSP00000360951 HR4753 gi|4507363|ref|NP_003180.1| NP_001274276.1.87134 NP_001274276.1.92137 NP_001277332.1.87134 NP_001277332.1.92137 NP_001277333.1.87134 NP_001277333.1.92137 NP_001277334.1.87134 NP_001277334.1.92137 NP_003180.1.87134 NP_003180.1.92137 XP_005271217.1.92137 XP_016857676.1.92137 XP_016857677.1.92137 XP_016857678.1.92137 XP_016857679.1.92137 XP_016857680.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]