SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361716 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361716
Domain Number 1 Region: 10-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-44
Family G proteins 0.0000244
Further Details:      
 
Domain Number 2 Region: 189-227
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000968
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361716   Gene: ENSG00000172476   Transcript: ENST00000372633
Sequence length 277
Comment pep:known chromosome:GRCh37:X:102754678:102757803:-1 gene:ENSG00000172476 transcript:ENST00000372633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPGSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDG
QRVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVP
KILVGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRM
NWLGRPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNARMMRGLS
YSLTTSSTHKSSLCKVEIVCPPQSPPKNCTRNSCKIS
Download sequence
Identical sequences Q8WXH6
NP_543155.2.87134 NP_543155.2.92137 XP_005262140.1.92137 XP_011529174.1.92137 ENSP00000305648 ENSP00000361716 9606.ENSP00000305648 gi|56550077|ref|NP_543155.2| ENSP00000305648 ENSP00000361716 ENSP00000305648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]