SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361903 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361903
Domain Number 1 Region: 281-361
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361903   Gene: ENSG00000116990   Transcript: ENST00000372816
Sequence length 364
Comment pep:known chromosome:GRCh37:1:40362899:40367554:-1 gene:ENSG00000116990 transcript:ENST00000372816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGP
PEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRG
NPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSENEEIDVVTVEKRQS
LGIRKPVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQEEASERGPQEEVLER
DAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSR
FLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAY
LTGY
Download sequence
Identical sequences P12524
NYSGXRC-13016a NP_001028253.1.87134 NP_001028253.1.92137 gi|74315995|ref|NP_001028253.1| ENSP00000361903 ENSP00000361903 9606.ENSP00000335376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]