SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362298 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362298
Domain Number 1 Region: 88-514
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.64e-118
Family Pyridoxal-dependent decarboxylase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362298   Gene: ENSG00000166224   Transcript: ENST00000373202
Sequence length 568
Comment pep:known chromosome:GRCh37:10:72575726:72640930:1 gene:ENSG00000166224 transcript:ENST00000373202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFV
FQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQG
LSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPG
LRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQS
AHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPE
VAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKG
SSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEAT
KQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP
PSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAE
LSSVFLDSLYSTDTVTQGSQMNGSPKPH
Download sequence
Identical sequences O95470
ENSP00000362298 NP_003892.2.87134 NP_003892.2.92137 XP_005270320.1.92137 XP_011538618.1.92137 XP_011538619.1.92137 gi|31982936|ref|NP_003892.2| ENSP00000299297 NYSGRC-31982936 9606.ENSP00000362298 ENSP00000362298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]