SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362950 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000362950
Domain Number - Region: 3-139
Classification Level Classification E-value
Superfamily Tropomyosin 0.0314
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362950   Gene: ENSG00000119397   Transcript: ENST00000373844
Sequence length 145
Comment pep:novel chromosome:GRCh37:9:123920121:123923783:1 gene:ENSG00000119397 transcript:ENST00000373844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERNEDHHLQVLKESEVLLQAKRAELEKLKSQVTSQQQEMAVLDRQLGHKKEELHLLQG
SMVQAKADLQEALRLGETEVTEKCNHIREVKSLLEELSFQKGELNVQISERKTQLTLIKQ
EIEKEEENLQVVLRQMSKHKTAFLQ
Download sequence
Identical sequences A0A2I3SMZ3 Q5JVD5
ENSP00000362950 ENSP00000362950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]