SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000363135 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000363135
Domain Number 1 Region: 22-64
Classification Level Classification E-value
Superfamily UBA-like 0.0000122
Family TAP-C domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000363135   Gene: ENSG00000196821   Transcript: ENST00000374023
Sequence length 298
Comment pep:known chromosome:GRCh37:6:34555065:34664624:-1 gene:ENSG00000196821 transcript:ENST00000374023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGG
DQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVE
VGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLKDPGGSEFDSISK
NTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS
Download sequence
Identical sequences A0A024RCW2 A0A0D9RBS3 A0A2K5LI25 A0A2K5UW21 A0A2K5ZCE2 A0A2K6CF24 A0A2K6QT62 G3RVN5 K7DPL6 Q9H6K1
ENSP00000363135 NP_077270.1.87134 NP_077270.1.92137 XP_003808589.1.60992 XP_004043905.1.27298 XP_005553309.1.63531 XP_007971074.1.81039 XP_010356362.1.97406 XP_011727466.1.29376 XP_011841925.1.47321 XP_011931286.1.92194 XP_016810766.1.37143 gi|13236514|ref|NP_077270.1| ENSGGOP00000000379 GO.36524 GO.57299 HR2545 ENSGGOP00000019865 9598.ENSPTRP00000039304 9606.ENSP00000363135 ENSP00000363135 ENSP00000363133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]