SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000363689 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000363689
Domain Number 1 Region: 42-86
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000363689   Gene: ENSG00000117318   Transcript: ENST00000374561
Sequence length 119
Comment pep:known chromosome:GRCh37:1:23884409:23886285:-1 gene:ENSG00000117318 transcript:ENST00000374561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH
Download sequence
Identical sequences Q02535
9606.ENSP00000363689 gi|156119621|ref|NP_002158.3| ENSP00000363689 NP_002158.3.87134 NP_002158.3.92137 ENSP00000363689 ENSP00000363689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]