SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000364094 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364094
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 2.11e-84
Family Integrin A (or I) domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 638-726
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.18e-22
Family Integrin beta tail domain 0.0012
Further Details:      
 
Domain Number 3 Region: 353-468
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-22
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 4 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000173
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Integrin beta EGF-like domains 0.0037
Further Details:      
 
Domain Number 6 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSP00000364094
Domain Number - Region: 520-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364094   Gene: ENSG00000150093   Transcript: ENST00000374956
Sequence length 825
Comment pep:known chromosome:GRCh37:10:33189328:33247147:-1 gene:ENSG00000150093 transcript:ENST00000374956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTSLS
VAQPGVQWCDISSLQPLTSRFQQFSCLSLPSTWDYRVKILFIRVP
Download sequence
Identical sequences ENSP00000420282 9606.ENSP00000364094 ENSP00000364094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]