SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365266 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365266
Domain Number 1 Region: 161-239,277-405
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000122
Family Cyclin A/CDK2-associated p19, Skp2 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365266   Gene: ENSG00000204479   Transcript: ENST00000376098
Sequence length 474
Comment pep:known chromosome:GRCh37:1:13716092:13719089:1 gene:ENSG00000204479 transcript:ENST00000376098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQSPSRLLELAGQSLLRNQFLTIFILDELPREVFPLMFMEASSMRHFEALKLMVQAWP
FLRLPLGSLMKTPHLETLQAVLKGLDTLLAQKLRPRRWKLQVLDLRDVDGNFWTIWSGAR
ALSCSPEAMSKRQTVEDYPRTGEHQPLKVFIDLCQKESTLDECLSYLCRWIHYRRGLVHL
CCNKVQNYSMPTSSFRNLLKRVYPDSIQELEIKRKCSLNKTGKFAPYLSQMSNLRKLFLA
FGYDDELYVSGQQQFVPDLDCPFLCLYYPQMLYIRKISNIKEHLEHLLRCLKNPLGTFIF
CHAYLADQDMECLSQYPSLSQLKELHLIHILMWTTNLEPLGALLEKVAATLEILTLKDCQ
IQDSQLRVLLPALSRCSQLTTFYFRGNETSTNALKDLLCHTGGLSKLGLELYPAPLECLD
NRGHVNWEILAPIRAELMCTLREVRQPKRIFFGPIPCPSCGSWPSEKVDFHLCS
Download sequence
Identical sequences Q5VTA0
NP_001093321.1.87134 NP_001093321.1.92137 ENSP00000365266 gi|157426839|ref|NP_001093321.1| ENSP00000365266 ENSP00000365266 9606.ENSP00000365266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]