SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365269 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365269
Domain Number 1 Region: 107-339
Classification Level Classification E-value
Superfamily RNI-like 1.12e-19
Family 28-residue LRR 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365269   Gene: ENSG00000204480   Transcript: ENST00000376101
Sequence length 410
Comment pep:known chromosome:GRCh37:1:13695525:13698151:-1 gene:ENSG00000204480 transcript:ENST00000376101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTPDLEILHYVVDGIDCLLAQKVRPRRWKLQVLEMRDVDENFWTIWSGARPLSCSPEAM
SKRQTVEDCPRTGEKQPLKVFMDVCLKEKSVDEDLSFFSGWVQHRRRSVHLCCTKVVNYS
MNILNFRNILETVYPDSIQVLEIWNMCWPCMVAEVSRYLSQMKNLRKLFISDGCGYLPSF
ESQGQLVAEFSSVFLRLEYLQMLYMRRIRFFEGYLDQLIRCLKSPLETLALTYGSLDEED
LKCLPWYPSLSQLKQLNLSHGTLRFIRLEPLRALLEKVAATLQTLFLVDCGIGYSKLRVI
LPALSRCSNLTTFCFHGNDTSMDGLKDLLRHTGRLSNLSLETYPAPRESLDNRGRVISEL
LTPLQAELMRILREVREPNRIFFGPVSCPCCGMSPTEQLEFNFCLRGRPA
Download sequence
Identical sequences ENSP00000365269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]