SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365302 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365302
Domain Number 1 Region: 166-423
Classification Level Classification E-value
Superfamily RNI-like 2.16e-19
Family 28-residue LRR 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365302   Gene: ENSG00000204495   Transcript: ENST00000376132
Sequence length 474
Comment pep:known chromosome:GRCh37:1:13447414:13452656:-1 gene:ENSG00000204495 transcript:ENST00000376132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIQAPPRLLELAGQSLLRDQALSISAMEELPRVLYLPLFMEAFRRRHFQTLTVMVQAWP
FTCLPLGSLMKTLHLETLKALLEGLHMLLTQKDRPRRWKLQVLDLRDVDENFWARWPGAW
ALSCFPETMSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYLFQWVYQRRGLVHL
CCSKLVNYLTPIKHLRKSLKIIYLNSIQQLEIRNMSWPRLIRKLRCYLKEMKNLRKLVFS
RCHHSMSDNELEGRLVTKFSSVFLRLEHLQLLKIKLITFFSGHLEQLIRCLQNPLENLEL
TYGYLLEEDMKCLSQYPSLGYLKHLNLSYVLLFRISLEPLGALLEKIAASLETLILEGCQ
IHYSQLSAILPGLSHCSQLTTFYFGRNCMSMGALKDLLRHTSGLSKLSLETYPAPEESLN
SLVRVDWEIFALLRAELMCTLREVRQPKRIFIGPTPCPSCGSSPSEELELHLCC
Download sequence
Identical sequences ENSP00000365302 gi|66954681|ref|NP_001019832.1| HR6142 9606.ENSP00000365302 ENSP00000365302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]