SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365338 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365338
Domain Number 1 Region: 179-409
Classification Level Classification E-value
Superfamily RNI-like 1.61e-20
Family 28-residue LRR 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365338   Gene: ENSG00000204502   Transcript: ENST00000376168
Sequence length 476
Comment pep:known chromosome:GRCh37:1:13359819:13369057:1 gene:ENSG00000204502 transcript:ENST00000376168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIRTPPRLLELAGRSLLRDQALAMSTLEELPTELFPPLFMEAFSRRRCEALKLMVQAWP
FRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVHPRRWKLQVLDLQDVCENFWMVWSEAM
AHGCFLNAKRNKKPVQDCPRMRGQQPLTVFVELWLKNRTLDEYLTCLLLWVKQRKDLLHL
CCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLVLS
HMDVSRYVSPEQKKEIVTQFTTQFLKLCCLQKLSMNSVSFLEGHLDQLLSCLKTSLKVLT
ITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLVPLQILLEKVAATLEYLDLDDC
GIIDSQVNAILPALSRCFELNTFSFCGNPISMATLENLLSHTIILKNLCVELYPAPRESY
DADGTLCWSRFAQIRAELMKRVRDLRHPKRILFCTDCCPDCGNRSFYDLEADQCCC
Download sequence
Identical sequences HR6145 9606.ENSP00000365338 ENSP00000365338 ENSP00000365363 gi|61696142|ref|NP_001013425.1| ENSP00000365338 ENSP00000365360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]