SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365343 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365343
Domain Number 1 Region: 179-410
Classification Level Classification E-value
Superfamily RNI-like 1.26e-18
Family 28-residue LRR 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365343   Gene: ENSG00000204503   Transcript: ENST00000376173
Sequence length 481
Comment pep:known chromosome:GRCh37:1:13328196:13331692:-1 gene:ENSG00000204503 transcript:ENST00000376173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSLQAPRRLLELAGQSLLGDQALAISILDELPRELFPPLFVEAFTSRRCEVLKVMVQA
WPFPCLPLGSLMKTPDLEILHYVVDGIDCLLAQKVRPRRRKLQVLELRDVDENFWTIWSG
ARPLSCSPEAMSKRQTVEDCPRTGEKQPLKVFMDVCLKEKFMDEDLSFFSGWVQHRRGSV
HLCCTKVVNYSMSILNFRNILETVYPDSIQVLEIWNMCWPCMIVEFIRYLSQMRNLRKLF
ISDGCRYLLSSDSQEQLVAEFSSVLLRLEYLQMLYVRRVCFFRGHLDQLIRCLRSPLETL
ALTYGFLEKVDLKCLPRYPSLSQLKQLNLSHGALRFIRLEPLRALLEKVAATLQTLFLVD
CGIRDSKLRVILPALSCCSNLTTFCFHGNDTSMDGLKDLLRHTGRLSNLSLETYPAPRES
LDDRGRVISELLTPLQAELMRILREVREPKRIFFGPVSCPCCGTSPTEQLEFNFCLWGRP
A
Download sequence
Identical sequences 9606.ENSP00000365343 gi|194306638|ref|NP_001013714.3| ENSP00000365343 ENSP00000365343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]