SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365358 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365358
Domain Number 1 Region: 181-410
Classification Level Classification E-value
Superfamily RNI-like 3.14e-18
Family 28-residue LRR 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365358   Gene: ENSG00000204508   Transcript: ENST00000376187
Sequence length 481
Comment pep:known chromosome:GRCh37:1:13035543:13038381:1 gene:ENSG00000204508 transcript:ENST00000376187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSLQAPRRLLELAGQSLLGDQALAISILDELPRELFPPLFVEAFTSRRCEVLKVMVQA
WPFPCLPLGSLMKTPDLEILHYVVDGIDCLLAQKVRPRRWKLQVLELRDVDENFWTIWSG
ARPLSCSPEAMSKRQTVEDCPRTGEKQPLKVFMDVCLKEKFMDEDLSFFSGWVQHRRGSV
HLCCTKVVNYSMSILNFRNILETVYPDSIQVLEIWNMCWPCMIVEFSRYLSQMRNLRKLF
ISDGCRYLLSSDSQEQLVAEFSSVLLRLEYLQMLYVRRVCFFRGHLDQLIRCLRSPLETL
ALTYGFLEKVDLKCLPRYPSLSQLKQLNLSHGALRFIRLEPLRALLEKVAATLQTLFLVD
CGIRDSKLRVILPALSCCSNLTTFCFHGNDTSMDGLKDLLRHTGRLSNLSLETYPAPRES
LDDRGRVISELLTPLQAELMRILREVREPKRIFFGPVSCPCCGTSPTEQLEFNFCLWGRP
A
Download sequence
Identical sequences A3QJZ6
ENSP00000365358 gi|154800493|ref|NP_001094101.1| ENSP00000365358 9606.ENSP00000365358 NYSGRC-154800493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]