SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365576 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365576
Domain Number 1 Region: 24-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.63e-24
Family Ubiquitin-related 0.0000285
Further Details:      
 
Domain Number 2 Region: 536-585
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000233
Family UBA domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSP00000365576
Domain Number - Region: 206-256
Classification Level Classification E-value
Superfamily ARM repeat 0.000213
Family Mo25 protein 0.032
Further Details:      
 
Domain Number - Region: 396-449
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0379
Family XPC-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365576   Gene: ENSG00000135018   Transcript: ENST00000376395
Sequence length 589
Comment pep:known chromosome:GRCh37:9:86274878:86323118:-1 gene:ENSG00000135018 transcript:ENST00000376395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQ
FKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQT
NTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLL
SNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLE
LARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLV
SNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTA
PNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLN
NPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGL
IPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQL
QNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences Q9UMX0
9606.ENSP00000365576 NP_038466.2.87134 NP_038466.2.92137 ENSP00000365576 ENSP00000365576 ENSP00000257468 gi|16753203|ref|NP_038466.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]