SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365623 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365623
Domain Number 1 Region: 256-309
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000413
Family UBA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365623   Gene: ENSG00000134882   Transcript: ENST00000376440
Sequence length 309
Comment pep:known chromosome:GRCh37:13:99853163:100038681:1 gene:ENSG00000134882 transcript:ENST00000376440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFFFSLQEEFLDKHTLMRVLSSGGKLGSRGEGAQLCCWMLLFSWRVSGGQQTRRLCRRA
FCWSPVPSPSCSPSSCLTARSSLCMTFTQSRTTSSLAPVFALFVPFYCSIPRVQVAQILG
PLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFS
WTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINW
NRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLN
VATNFLLQH
Download sequence
Identical sequences NP_808882.1.87134 NP_808882.1.92137 gi|29366838|ref|NP_808882.1| ENSP00000365623 NYSGRC-29366838 ENSP00000365623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]